Scaffold JGI24707J26582_10046747

Overview

Basic Information

• Taxon OID: 3300002163
• Scaffold ID: JGI24707J26582_10046747
• Source Dataset Name: Biogas fermentation microbial communities from Germany - Plant 1 DNA1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1635
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location

• Location Name: Bielefeld, North Rhine-Westphalia, Germany
• Coordinates
  • Lat. (^o): 52.0385
  • Long. (^o): 8.4956
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091649	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24707J26582_100467471	F091649	N/A	KQMVKKNGICDPYEKSIREFKEEFERIEKKLKQTGG*