| Basic Information | |
|---|---|
| Taxon OID | 3300002161 Open in IMG/M |
| Scaffold ID | JGI24766J26685_10009245 Open in IMG/M |
| Source Dataset Name | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2670 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae → Gemmataceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sandusky Bay, Ohio, USA | |||||||
| Coordinates | Lat. (o) | 41.474889 | Long. (o) | -82.854137 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033772 | Metagenome / Metatranscriptome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24766J26685_100092453 | F033772 | N/A | MTTYLTLDCALRSETDPQVIANLERKGWQVTTPPTYDPATEQAPVWEACAWVVKPLPPPQPYRVSKDTIVSRVLAAGKLNDLITLTNGLPEDQAYLWNNFAWFWDTNPTIVGMCTQLGLDPAVILAPDPYLT* |
| ⦗Top⦘ |