NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24538J26636_10039357

Scaffold JGI24538J26636_10039357


Overview

Basic Information
Taxon OID3300002154 Open in IMG/M
Scaffold IDJGI24538J26636_10039357 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1149
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)78.8697Long. (o)8.1122Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006719Metagenome / Metatranscriptome366Y

Sequences

Protein IDFamilyRBSSequence
JGI24538J26636_100393573F006719N/AMEIKIMTDINYTPEMVAVLKAAQPINYAKAQELAKQLDRGVRSIIAKTKREGFDYISKPAPAKKKAAPTKGDMVAAICSALDMDTCEGLEKSTGSALNKLLQNIA*H*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.