| Basic Information | |
|---|---|
| Taxon OID | 3300002153 Open in IMG/M |
| Scaffold ID | JGI24540J26637_10215730 Open in IMG/M |
| Source Dataset Name | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 500 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Kamptonema → Kamptonema sp. PCC 6506 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norwegian Sea, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 73.0188 | Long. (o) | 9.8566 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026265 | Metagenome / Metatranscriptome | 198 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24540J26637_102157301 | F026265 | N/A | ARVVHEELGEREGVAGACGNLGDCCLSTGDYGLAISYFTEQYNMAKEVQVEAHQAEAALGMGVALRLEVXANVRGRAAGASELPGPSASESACSDDGVREAEKWLQTALDLGRTAARLHLACLVFDAGPEDTALAHLQDYLSWCVARGRNRCAGCDQTRGEDAQML |
| ⦗Top⦘ |