Scaffold S2t7BSb_10961255

Overview

Basic Information

• Taxon OID: 3300002145
• Scaffold ID: S2t7BSb_10961255
• Source Dataset Name: S2t7BSb (114f)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1609
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. SCGC AAA160-P02 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location

• Coordinates
  • Lat. (^o): 57.305
  • Long. (^o): 20.0745
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059468	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
S2t7BSb_109612555	F059468	AGGA	MSRIIVLEKISREADELARQYNKTKDSGLRDQWYELIKKVSQVDPKDHLQDKQT*