| Basic Information | |
|---|---|
| Taxon OID | 3300002145 Open in IMG/M |
| Scaffold ID | S2t7BSb_10436491 Open in IMG/M |
| Source Dataset Name | S2t7BSb (114f) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 631 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium TMED154 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | 57.305 | Long. (o) | 20.0745 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017490 | Metagenome / Metatranscriptome | 240 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| S2t7BSb_104364912 | F017490 | N/A | MAFQGSMKLKGATTSAGAAITAQDFGRAHFVRIQSQAATNTVTVKEGSDVIGSAILVTAGDSIVIEKEESHTITTSGNAVGSAVSSTR* |
| ⦗Top⦘ |