| Basic Information | |
|---|---|
| Taxon OID | 3300002144 Open in IMG/M |
| Scaffold ID | M2t2BS2_11179516 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 855 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 57.305 | Long. (o) | 20.0745 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016669 | Metagenome / Metatranscriptome | 245 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| M2t2BS2_111795164 | F016669 | N/A | GLDNKISFISGFIFTALSTVSLMGVAQAAMVGLVGGFFGLLGKELYYFIKKKINEKVNR* |
| ⦗Top⦘ |