NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M3t6FKB2_10850440

Scaffold M3t6FKB2_10850440


Overview

Basic Information
Taxon OID3300002143 Open in IMG/M
Scaffold IDM3t6FKB2_10850440 Open in IMG/M
Source Dataset NameM3t6FKB2 (118f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1744
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)65.3915Long. (o)23.49916667Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049614Metagenome / Metatranscriptome146N
F074551Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
M3t6FKB2_108504402F049614GGAMTNSRMKGKNGELDACRALGKLFPFTWERTAQRYGKGKADIEAQCDWKIHVEVKRRKSGYSYVYGRLANDNLIVSGSLLICRLSKLRTVMDDGVCLPNVAPRCAGLEDAMLQARTDARVGWLPIVLARQDDEEWLLAWREEVDTRLMEEVRTWLGDGDSKVA*
M3t6FKB2_108504403F074551GGAMSQPQSLEDQILQQVLVIQALRLRIARMESIYTTPRTIRSTGQNGTTEDTRHQRDTIEEYGPITPRCVTDQEVDQAEDDGA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.