NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M3t6FKB2_10175647

Scaffold M3t6FKB2_10175647


Overview

Basic Information
Taxon OID3300002143 Open in IMG/M
Scaffold IDM3t6FKB2_10175647 Open in IMG/M
Source Dataset NameM3t6FKB2 (118f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3256
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)65.3915Long. (o)23.49916667Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064405Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
M3t6FKB2_101756473F064405N/AMNGGPSTGRGPALVVCLLGGLIAFALALVGLVPEGDFSVKEPLDLIKLLFVFAPAFPFLLLAGIATLLKDRFFLTGTIVIAVLLILSCGLYLAAQAEQRVRPDDSMHALTYLIVPFLQVPAIFTVFGLLALWRAWLGRNA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.