NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M3t6FKB1_1431305

Scaffold M3t6FKB1_1431305


Overview

Basic Information
Taxon OID3300002138 Open in IMG/M
Scaffold IDM3t6FKB1_1431305 Open in IMG/M
Source Dataset NameM3t6FKB1 (102f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2126
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)65.3915Long. (o)23.49916667Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054597Metagenome / Metatranscriptome139N

Sequences

Protein IDFamilyRBSSequence
M3t6FKB1_14313051F054597AGGAGMIWTRRVLQTNSTESLALGTEACKIFKDVTGADLALWSPLGGMPFTALAWTATAEDFNESVERGFKLGASDAWADLMQRSAGTATTIQEFPDNVLSFHAISSSFTPHTVGSVVMGTSLTMKDGADYFGALKYLTEWCEVAASATGAGVIVSIPMFGAAGVIEISSFYPNAKSAEDGRNAAMASTTWLTKFMEGGAFFNSGMNRTAIMRIA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.