Scaffold S2T7BSa_1645449

Overview

Basic Information

• Taxon OID: 3300002133
• Scaffold ID: S2T7BSa_1645449
• Source Dataset Name: Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - S2T7BSa (116f)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2292
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCGC AAA164-I21 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 57.305
  • Long. (^o): 20.0745
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011355	Metagenome / Metatranscriptome	292	N

Sequences

Protein ID	Family	RBS	Sequence
S2T7BSa_16454492	F011355	GAGG	MKSLVVIVILLANPDNLEKNYYPVDTEDSCDVVGQRIIEQIAKYKDNIGEHQGWYTLDNKLVVGHYCTVK*