Scaffold M2t6BS2_1375268

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M2t6BS2_1375268

Scaffold M2t6BS2_1375268

Overview

Basic Information
Taxon OID	3300002132 Open in IMG/M
Scaffold ID	M2t6BS2_1375268 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14810
Total Scaffold Genes	31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (19.35%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	57.305	Long. (^o)	20.0745	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037121	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
M2t6BS2_13752688	F037121	N/A	MKITLKHYGVTYSIETKEDDFDAAEMINTFNNLMLCAGWQQDSIDDAIMGLNEQIDLEQCYNETYGETN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.