Basic Information | |
---|---|
Taxon OID | 3300002131 Open in IMG/M |
Scaffold ID | M2t2BS1_1030520 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1140 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 57.305 | Long. (o) | 20.0745 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027842 | Metagenome | 193 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M2t2BS1_10305203 | F027842 | GAGG | MFLYNLIAPLVFIAVFSLPALLLELQLLVIGLDGMTPNIMIATAVIGLLSAIGALICEELG* |
⦗Top⦘ |