Scaffold JGI20165J26630_10083678

Overview

Basic Information

• Taxon OID: 3300002125
• Scaffold ID: JGI20165J26630_10083678
• Source Dataset Name: Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1280
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Kakamega Forest, Kenya
• Coordinates
  • Lat. (^o): 0.2917
  • Long. (^o): 34.856

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003907	Metagenome	462	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20165J26630_100836783	F003907	N/A	YAATPPNQPEQCVLTDYFNNYKFSKAQIIRSLMVVIKPKHVGAVLM*