NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C687J26634_10105100

Scaffold C687J26634_10105100


Overview

Basic Information
Taxon OID3300002123 Open in IMG/M
Scaffold IDC687J26634_10105100 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1005
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091066Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
C687J26634_101051002F091066AGGAMKKDTRMSDEIRKIMDEELKAQPTPSLRKFADWLMESMSKDDDGTVSHNSIANWKNGKPPATDFLEDMLSVYPASDRRFVFALRMLAAKAPHIWGEDGTVWSLKARLPKAE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.