Scaffold C687J26616_10052102

Overview

Basic Information

• Taxon OID: 3300002120
• Scaffold ID: C687J26616_10052102
• Source Dataset Name: Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1417
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019625	Metagenome / Metatranscriptome	228	Y

Sequences

Protein ID	Family	RBS	Sequence
C687J26616_100521022	F019625	GGA	VQGKTWKGASPGALAQVRELLLRRGAVEDKDLKDSHEAWRVRIEKSVFTGYRSGTIYCNGGDLPELPFLYESIAQVLGQS*