Basic Information | |
---|---|
Taxon OID | 3300002100 Open in IMG/M |
Scaffold ID | JGI24809J26612_1006031 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3095 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Manhattan, Kansas, USA | |||||||
Coordinates | Lat. (o) | 39.214 | Long. (o) | -96.5852 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030451 | Metagenome / Metatranscriptome | 185 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24809J26612_10060315 | F030451 | N/A | VPQNTFTRSEKEKFLDNYFLLRLQKLINKINAPESKSRKDHVENIFDSLMDIADEYQAVMVEDEDENYWESIDMWDDELKQMNAINWVNSSIQEQQTKT* |
⦗Top⦘ |