| Basic Information | |
|---|---|
| Taxon OID | 3300002091 Open in IMG/M |
| Scaffold ID | JGI24028J26656_1028517 Open in IMG/M |
| Source Dataset Name | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 507 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brandenburg, Germany | |||||||
| Coordinates | Lat. (o) | 53.1666 | Long. (o) | 13.0333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008414 | Metagenome | 333 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24028J26656_10285171 | F008414 | AGGA | MTQCIVFAQDNGQVAVCIPTGELPINEVLAKDCPAGAQIVDDSALPQGADAQFFDAWELADGQVSVNFEKAKAIKLAQFNAAAVQEAQKRQLNTLAGINNEVADADFKAKLDAGRASIASATTTAELVAX* |
| ⦗Top⦘ |