| Basic Information | |
|---|---|
| Taxon OID | 3300002090 Open in IMG/M |
| Scaffold ID | JGI24806J26614_1006735 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2423 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Manhattan, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.214 | Long. (o) | -96.5852 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018099 | Metagenome | 237 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24806J26614_10067353 | F018099 | N/A | MARTYIVDIAGGTATVTVQAQATQTLKSATWSGVGAAAGKWELSYSSTSQIGTAQPDSNVIARISLGVLTSGGTFGVQMPINMPVKAFQSIYVHCTGAGNLGTVTLS* |
| ⦗Top⦘ |