NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24744J21845_10021316

Scaffold JGI24744J21845_10021316


Overview

Basic Information
Taxon OID3300002077 Open in IMG/M
Scaffold IDJGI24744J21845_10021316 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1275
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098103Metagenome / Metatranscriptome104Y
F101249Metagenome102Y

Sequences

Protein IDFamilyRBSSequence
JGI24744J21845_100213161F101249N/ADGVPDPFVASYIASSSGVATGSAKGPTFDLDGKPVNLEDYKILTYSQLFSGQWGIADFWALRLRMLGSFYSGTNAPGLVGVGVNGLVRGSVGTTLGFQLADRLRLGVLIDVTWGPSVAVSILDTIRQSVSSGSVQALVDNSYSTTVTPTVSLAWAIARGWGAIFNATYANGVVEVNQGTSDADMAVVQATVEVDLRELGSIPLGIGADYSAGYSLGRTRFRRYVAGLGFFFTGRPGLTVGLDLSYRRAPLGSAEVFVSSFSGTFALRYTFD*
JGI24744J21845_100213162F098103GGAGGMRASSAWLAWLASLVLLGCAPTKIENTWTSGQPPPQPIRKFAVFAVTGSPSGRIAYEETLTTRLKEAGLPAVPGYDLVTYDEHPSKDEVLRRLADKQIDGALVSRIDRRTTKTESSPVWVGGGVPTMGFYDY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.