Scaffold SMTZ23_10041054

Overview

Basic Information

• Taxon OID: 3300002053
• Scaffold ID: SMTZ23_10041054
• Source Dataset Name: Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6282
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (64.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location

• Location Name: White Oak River estuary, North Carolina, USA
• Coordinates
  • Lat. (^o): 34.6478111
  • Long. (^o): -77.1112083
  • Depth (m): .24 to .32

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038920	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
SMTZ23_100410541	F038920	N/A	GVKSLLTEITSDEQLIELYTKGGFLIAVDYPKNQLKLHTIDCMLADPISSVGVKPSKSKTSKTGEFWYSKDRSEVISKAKEIARKKGYTYLVCPICDR*