| Basic Information | |
|---|---|
| Taxon OID | 3300002040 Open in IMG/M |
| Scaffold ID | GOScombined01_101742176 Open in IMG/M |
| Source Dataset Name | GS000c - Sargasso Station 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2111 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Moorea, Outside Cooks Bay, Polynesia Archipelagos | |||||||
| Coordinates | Lat. (o) | -17.475834 | Long. (o) | -149.81223 | Alt. (m) | Depth (m) | 1.4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006794 | Metagenome | 364 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOScombined01_1017421763 | F006794 | N/A | MNRKLNTLVKVGLPVVIVIQLISITYLLARSGKDKAFSCKMINPYIICRQIEADI* |
| ⦗Top⦘ |