Scaffold GOScombined01_100230947

Overview

Basic Information

• Taxon OID: 3300002040
• Scaffold ID: GOScombined01_100230947
• Source Dataset Name: GS000c - Sargasso Station 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 777
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Moorea, Outside Cooks Bay, Polynesia Archipelagos
• Coordinates
  • Lat. (^o): -17.475834
  • Long. (^o): -149.81223
  • Depth (m): 1.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048175	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
GOScombined01_1002309471	F048175	GAGG	MSSGSFEFRFRHQNEEATWYKNPDTKFALPDEDVNITCDDPYLNENQFLEMVRRFFIAVGYTDQQWKDALKVHLKEVETE*