Scaffold GOScombined01_100139865

Overview

Basic Information

• Taxon OID: 3300002040
• Scaffold ID: GOScombined01_100139865
• Source Dataset Name: GS000c - Sargasso Station 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5772
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Moorea, Outside Cooks Bay, Polynesia Archipelagos
• Coordinates
  • Lat. (^o): -17.475834
  • Long. (^o): -149.81223
  • Depth (m): 1.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037812	Metagenome / Metatranscriptome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
GOScombined01_1001398655	F037812	N/A	MIKWLKITAGINLYLSVIMTLVLVALVTDIVLDTYWHSNAYIEQFKNSDK*