Scaffold GOS24894_10259952

Overview

Basic Information

• Taxon OID: 3300002033
• Scaffold ID: GOS24894_10259952
• Source Dataset Name: Marine microbial communities from the Sargasso Sea - GS000a &b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1735
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Sargasso Sea
• Coordinates
  • Lat. (^o): 31.175
  • Long. (^o): -64.32433
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014744	Metagenome / Metatranscriptome	260	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS24894_102599523	F014744	N/A	MYNQLNQKLSEVKSGNYLIKVTSIGDKRPNKYYSKEYFVTVKYQVTDLNNPKRKYGVIVAGMGAKPIELNIDRELLPTNYFIWENFDEVLFERLTRWQNSINQEGYYPKDRDTGQVVVLNDNLKGDK