| Basic Information | |
|---|---|
| Taxon OID | 3300002027 Open in IMG/M |
| Scaffold ID | MIS_10010246 Open in IMG/M |
| Source Dataset Name | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4128 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Middle Island Sinkhole, Lake Huron Michigan, USA | |||||||
| Coordinates | Lat. (o) | 45.19843 | Long. (o) | -83.32721 | Alt. (m) | Depth (m) | 23 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081567 | Metagenome / Metatranscriptome | 114 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MIS_100102462 | F081567 | AGGA | MRVAIKATEEAIIRLLKAGHPLPGDVVDRELETRLPVFQSVEAVPVKTYGLEGFGRIVIARGRKDVWFVDIKRKDGKLSVKDGESFLDMRDKLQQRYPGQKVTGWLVTTADVDVKAKSVIAEKGCFATAGAAKR* |
| ⦗Top⦘ |