| Basic Information | |
|---|---|
| Taxon OID | 3300002026 Open in IMG/M |
| Scaffold ID | MIS_10005856 Open in IMG/M |
| Source Dataset Name | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+ |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 19535 |
| Total Scaffold Genes | 22 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (9.09%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Middle Island Sinkhole, Lake Huron Michigan, USA | |||||||
| Coordinates | Lat. (o) | 45.19843 | Long. (o) | -83.32721 | Alt. (m) | Depth (m) | 23 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087946 | Metagenome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MIS_1000585621 | F087946 | N/A | MLSKQRIPDLIVIAVLGLLLVLLNYTGNIGIMSDYPFIFLLVMYFLGRAVTWYIINQHMDEGDGGKEQE* |
| ⦗Top⦘ |