Scaffold Draft_11123931

Overview

Basic Information

• Taxon OID: 3300001975
• Scaffold ID: Draft_11123931
• Source Dataset Name: Biogas fermenter microbial communities from the University of Hamburg, Germany
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 501
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany

Source Dataset Sampling Location

• Location Name: University of Hamburg, Germany
• Coordinates
  • Lat. (^o): 53.458783
  • Long. (^o): 9.968812

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079824	Metagenome / Metatranscriptome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Draft_111239311	F079824	N/A	LSPCVPWQSQSIPGCPHQRGSHALRGNGKTLCLTFVGYLDYLSGRDVISNYKTSFSEFVSTERIAEMVIYEDIRDTTILLSELQLYMNSLGVNTKELRSFVGSVIGQSRKRNTDIHYDTQRYTDVHPRIRVQTDRAFLPRKFHADGKPCQLDRCDSAHFIYLYQHL