Scaffold Draft_11087771

Overview

Basic Information

• Taxon OID: 3300001975
• Scaffold ID: Draft_11087771
• Source Dataset Name: Biogas fermenter microbial communities from the University of Hamburg, Germany
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 521
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany

Source Dataset Sampling Location

• Location Name: University of Hamburg, Germany
• Coordinates
  • Lat. (^o): 53.458783
  • Long. (^o): 9.968812

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022442	Metagenome / Metatranscriptome	214	Y

Sequences

Protein ID	Family	RBS	Sequence
Draft_110877711	F022442	GGGGG	MTFIPAGEARLDLYTDALILDIGRDTFVVPLARLADLTAHRRREVVVSRRYWGDAPGVFEDVEQALRLRRSQTDRSLMLTEQGRVYTMPIRAVHDVREGREESCGISLLVTDARQLDDAHSRQTVLEVRT*