| Basic Information | |
|---|---|
| Taxon OID | 3300001975 Open in IMG/M |
| Scaffold ID | Draft_10019440 Open in IMG/M |
| Source Dataset Name | Biogas fermenter microbial communities from the University of Hamburg, Germany |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 544 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Hamburg, Germany | |||||||
| Coordinates | Lat. (o) | 53.458783 | Long. (o) | 9.968812 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091648 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Draft_100194401 | F091648 | N/A | MLQVNVYCSGNNPLIGEKPMTENDKLELSNLETVERNLKAALNAWTDEINVSELPKALQRKHRVVSDKTAALMYDVHQYLATKRRVGRPAGGITKTTVRELKNATPEQLAAIAKILGKEAKVPPLSADMENVEEVNDKSEKVKAIPIADTGILAELDEED |
| ⦗Top⦘ |