Scaffold GOS2246_10081625

Overview

Basic Information

• Taxon OID: 3300001974
• Scaffold ID: GOS2246_10081625
• Source Dataset Name: Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1539
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Upwelling, Fernandina Island, Equador
• Coordinates
  • Lat. (^o): -0.3011111
  • Long. (^o): -91.651665
  • Depth (m): 12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025761	Metagenome / Metatranscriptome	200	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2246_100816252	F025761	N/A	MKLYALVALVFGASAHKIEQKAPPCVYLDETQAELDKQIDLFSKTLDVRHWTNVLNIAGALKDKSGVAPKLQVHTWELLDKAFTFPRIRRYAYVQENMDMLEHFEDNLNTNISNSVNMANFLKVANTVKKNLNTKYHNGEFADPAVDAYKED*A*