Basic Information | |
---|---|
Taxon OID | 3300001974 Open in IMG/M |
Scaffold ID | GOS2246_10004037 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1849 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upwelling, Fernandina Island, Equador | |||||||
Coordinates | Lat. (o) | -0.3011111 | Long. (o) | -91.651665 | Alt. (m) | Depth (m) | 12 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098740 | Metagenome | 103 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2246_100040371 | F098740 | N/A | MVGVPLQAGHAGSATGVGSVYATNVQQELVRHRRPLSLRMLARVLNDCEQKGKSIHPGLVRWASRAVSSEEGQNTFQESGDQLFGRPSFQSISSISN* |
⦗Top⦘ |