Scaffold GOS2215_10105061

Overview

Basic Information

• Taxon OID: 3300001971
• Scaffold ID: GOS2215_10105061
• Source Dataset Name: Marine microbial communities from the Sargasso Sea - GS000c
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1676
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Sargasso Sea
• Coordinates
  • Lat. (^o): 32.174835
  • Long. (^o): -64.01017
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007288	Metagenome / Metatranscriptome	354	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2215_101050614	F007288	N/A	QGTEEAVDAEVVEEAEVAQLPPNPEMLTARMDELREEIGQITNVINANQKQLDTYVAAFNWYSQQLEAVNAEQQ*