| Basic Information | |
|---|---|
| Taxon OID | 3300001970 Open in IMG/M |
| Scaffold ID | GOS2248_10053676 Open in IMG/M |
| Source Dataset Name | Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1346 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Punta Cormorant, Floreana Island, Equador | |||||||
| Coordinates | Lat. (o) | -1.2283334 | Long. (o) | -90.42917 | Alt. (m) | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058114 | Metagenome / Metatranscriptome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2248_100536762 | F058114 | GGAGG | MIEITFTREELSHLYDVLLKNHLQVKQSVMNKIDEELIADEIFELLGELECLDTYLNDEWQDKLWYDDPEDEYTIAVKRCRNLWNRQTIAELKSIIAKLEENK* |
| ⦗Top⦘ |