Scaffold GOS2233_1067282

Overview

Basic Information

• Taxon OID: 3300001969
• Scaffold ID: GOS2233_1067282
• Source Dataset Name: Marine microbial communities from Yucatan Channel, Mexico - GS017
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1823
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Yucatan Channel, Mexico
• Coordinates
  • Lat. (^o): 20.5225
  • Long. (^o): -85.41361
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017658	Metagenome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2233_10672824	F017658	N/A	MNFMEEINEETQKMLKQISIRKAEKTANAKKRIAELQTLIKFWEQDL*