Scaffold GOS2236_1091807

Overview

Basic Information

• Taxon OID: 3300001968
• Scaffold ID: GOS2236_1091807
• Source Dataset Name: Marine microbial communities from Lake Gatun, Panama - GS020
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2545
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Lake Gatun, Panama
• Coordinates
  • Lat. (^o): 9.164444
  • Long. (^o): -79.83611
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061681	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2236_10918072	F061681	N/A	MHDKSIINWELHQKIMAKKKTIKIYTGIGLNMFFPEYITIELTDIDTEIKKRGHKPKQ*