Basic Information | |
---|---|
Taxon OID | 3300001968 Open in IMG/M |
Scaffold ID | GOS2236_1066919 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Lake Gatun, Panama - GS020 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1416 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Gatun, Panama | |||||||
Coordinates | Lat. (o) | 9.164444 | Long. (o) | -79.83611 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053294 | Metagenome | 141 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2236_10669192 | F053294 | N/A | MKSIKNFIKSLLGDGSDVSSKRFSGIVTLLNLIILAYVATQKSGVCPEYMYDTLSLLCGGFLGLTTIEAIFGKKKNPETKSE* |
⦗Top⦘ |