| Basic Information | |
|---|---|
| Taxon OID | 3300001968 Open in IMG/M |
| Scaffold ID | GOS2236_1051022 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Lake Gatun, Panama - GS020 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2357 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Gatun, Panama | |||||||
| Coordinates | Lat. (o) | 9.164444 | Long. (o) | -79.83611 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043932 | Metagenome / Metatranscriptome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2236_10510223 | F043932 | AGGAG | MPKLKSLLNLVTLEEDPIAGSTGDVYFNTISKNIKIYNGAIWVDLTPGSTDPAPFYMHTHSYEGDVHTINIQETINFNTDVNNQPSVLEEIPVIIGIDGGEPESTYNNASYTQLTLLDGGDLGN* |
| ⦗Top⦘ |