| Basic Information | |
|---|---|
| Taxon OID | 3300001967 Open in IMG/M |
| Scaffold ID | GOS2242_1099947 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1659 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Devil's Crown, Floreana Island, Equador | |||||||
| Coordinates | Lat. (o) | -1.2161111 | Long. (o) | -90.422775 | Alt. (m) | Depth (m) | 2.2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103871 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2242_10999474 | F103871 | AGG | MVQIPDLILDNSKKKPPAKAWSEDFCALAGFIKRPQVALTRR* |
| ⦗Top⦘ |