Scaffold GOS2242_1097938

Overview

Basic Information

• Taxon OID: 3300001967
• Scaffold ID: GOS2242_1097938
• Source Dataset Name: Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1443
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Devil's Crown, Floreana Island, Equador
• Coordinates
  • Lat. (^o): -1.2161111
  • Long. (^o): -90.422775
  • Depth (m): 2.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027532	Metagenome	194	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2242_10979382	F027532	N/A	MALSNTPVLYKVKKKRNIIKAIIANAVRIFFLFVFLSGVIIKFYLSEKGQKLKINKVLNIQILIWAFFGLNLFFL*