NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2242_1029184

Scaffold GOS2242_1029184


Overview

Basic Information
Taxon OID3300001967 Open in IMG/M
Scaffold IDGOS2242_1029184 Open in IMG/M
Source Dataset NameMarine microbial communities from Devil's Crown, Floreana Island, Equador - GS027
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2578
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameDevil's Crown, Floreana Island, Equador
CoordinatesLat. (o)-1.2161111Long. (o)-90.422775Alt. (m)Depth (m)2.2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065103Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
GOS2242_10291843F065103N/AMKVWIIISVMFLMESSQVKIAETVNDSSRFFSTEKQCLNSLENKMLDGDKMVEFFGGSFVTGGSVFQNIKQCVAIELQEKQLKRLLREMK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.