| Basic Information | |
|---|---|
| Taxon OID | 3300001964 Open in IMG/M |
| Scaffold ID | GOS2234_1045157 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Rosario Bank, Honduras - GS018 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1710 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rosario Bank, Honduras | |||||||
| Coordinates | Lat. (o) | 18.036667 | Long. (o) | -83.78472 | Alt. (m) | Depth (m) | 1.7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065212 | Metagenome | 128 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2234_10451573 | F065212 | GAG | MNLLPEKRKSTKISEKEELFLQNLFSNGGFVVAAAENAGYTKGSAGYLRSKLSDEIIRRSKNLLASASVKATNKLISLIDSPQIERGDDLRLKAAESLLNRVGLGKEETHNHNVQALHGVVLLPAKKGVING* |
| ⦗Top⦘ |