NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2234_1036304

Scaffold GOS2234_1036304


Overview

Basic Information
Taxon OID3300001964 Open in IMG/M
Scaffold IDGOS2234_1036304 Open in IMG/M
Source Dataset NameMarine microbial communities from Rosario Bank, Honduras - GS018
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1768
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameRosario Bank, Honduras
CoordinatesLat. (o)18.036667Long. (o)-83.78472Alt. (m)Depth (m)1.7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012719Metagenome / Metatranscriptome278Y
F043347Metagenome156N

Sequences

Protein IDFamilyRBSSequence
GOS2234_10363041F043347N/ANYSKGDKVFLAACYFLLNEFKRVKSESDKTEAVESEQVLKVQGDLKKLVKEYGSVRLVIGKETFDVDDFKQVPGRPKADMIFTKNGQPRVFVSHKKGNMPAAFQQYGGFAADLGIKDLDTSKRYKEVFKFLTDVNTTLKGLGVSKDSEDRYDLNDLRKGSNMARLIKDEMIAMTVMFGKNYSTGIIGLDNCSILIDGDIIFKPKRLNTFELQGSFHTSINPKLQKIKKPFRSVASDVYSPVMFIMKSEQQGLKQAGLTNARAVIWPNNK
GOS2234_10363043F012719GGAMDKYLKWVATLFLMIGVGANSLAIYPAGPLFTLAGGLTWLIVSIMWKEAALITTNLVLSAITIVGLVYTYVH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.