Scaffold GOS2234_1030671

Overview

Basic Information

• Taxon OID: 3300001964
• Scaffold ID: GOS2234_1030671
• Source Dataset Name: Marine microbial communities from Rosario Bank, Honduras - GS018
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1954
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Rosario Bank, Honduras
• Coordinates
  • Lat. (^o): 18.036667
  • Long. (^o): -83.78472
  • Depth (m): 1.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054943	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2234_10306712	F054943	GGAGG	MKHLIPLTKNQLQIVQASLQLSLKYADSQYVENVDEIMQIIEDNSSL*