Scaffold GOS2229_1063252

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2229_1063252

Scaffold GOS2229_1063252

Overview

Basic Information
Taxon OID	3300001963 Open in IMG/M
Scaffold ID	GOS2229_1063252 Open in IMG/M
Source Dataset Name	Marine microbial communities from Nags Head, North Carolina, USA - GS013
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	967
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Nags Head, North Carolina, USA
Coordinates	Lat. (^o)	35.6	Long. (^o)	-75.82	Alt. (m)		Depth (m)	2.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019313	Metagenome	230	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2229_10632523	F019313	N/A	KNRNQMSYTNEEREEIAKNIREYMKQPKTEKFEEVSYSGMKVLHRREHNMTWYDREWLETIARDVEGRILHP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.