Scaffold GOS2229_1006150

Overview

Basic Information

• Taxon OID: 3300001963
• Scaffold ID: GOS2229_1006150
• Source Dataset Name: Marine microbial communities from Nags Head, North Carolina, USA - GS013
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1838
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Nags Head, North Carolina, USA
• Coordinates
  • Lat. (^o): 35.6
  • Long. (^o): -75.82
  • Depth (m): 2.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002267	Metagenome / Metatranscriptome	576	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2229_10061503	F002267	AGG	MAIAFGPGITIEGGVSVGPMLVISQPLVYDLDAENYSAVPVNGSTVAGTGGYTVTVANAGSRLSWNSANNGVFRFTGSGTTTTDTMYGGPNWATGQSYSVFMAYKLSTAASGRLLNTQSEASKDWLMGAYNGNPNTFYPNFSVNLPATGADQVWHFGWATWNTTTSTGQLWIATNTQPTNYSYTGTNAGGGGFNQLRLFSRSAGSEVQTGDIGFVKAYSGVLTLADIQGLYNYYKAR