Scaffold GOS2239_1057141

Overview

Basic Information

• Taxon OID: 3300001962
• Scaffold ID: GOS2239_1057141
• Source Dataset Name: Marine microbial communities from Cocos Island, Costa Rica - GS023
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1616
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED237 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Cocos Island, Costa Rica
• Coordinates
  • Lat. (^o): 5.64
  • Long. (^o): -86.56528
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031465	Metagenome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2239_10571415	F031465	AGGAG	MLLNRKMVKDLRAILDDALNDNESLKEFIVEVGSANFSDTEVTFKVNLRMNGAKSQSQKDLEFYGNMDNLDLSKIAKLDGKDFSLSGFRRKARTKPYLIQDLKTGGEYIITTATAKR