NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2240_1037460

Scaffold GOS2240_1037460


Overview

Basic Information
Taxon OID3300001961 Open in IMG/M
Scaffold IDGOS2240_1037460 Open in IMG/M
Source Dataset NameMarine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)905
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Nilusvirus → Nilusvirus ssm2(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameDirty Rock, Cocos Island, Costa Rica
CoordinatesLat. (o)5.552778Long. (o)-87.087776Alt. (m)Depth (m)1.1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033077Metagenome / Metatranscriptome178Y

Sequences

Protein IDFamilyRBSSequence
GOS2240_10374603F033077N/AVAKATIFLHKNMTTPQPDTPTYKVLRLTTEGWTDFDSRTAVNLTKAQCDQVLHNLVHLEGIDFRELKAVRDN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.