Scaffold GOS2240_1004593

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2240_1004593

Scaffold GOS2240_1004593

Overview

Basic Information
Taxon OID	3300001961 Open in IMG/M
Scaffold ID	GOS2240_1004593 Open in IMG/M
Source Dataset Name	Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1521
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Dirty Rock, Cocos Island, Costa Rica
Coordinates	Lat. (^o)	5.552778	Long. (^o)	-87.087776	Alt. (m)		Depth (m)	1.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078604	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2240_10045933	F078604	N/A	MSNDFYIISTNSYIKNVSKYLDMDFLKELKTSNNELKPHISNLDTNSIYYGKKCIKCTIPTLFISIEYKDINKDIYLIDHEVFLYEEDYPTMEALENYKTKFDFNFASQVNPEVYEIIDAFHNGYGCMCLSSEGY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.