Scaffold GOS2230_1005877

Overview

Basic Information

• Taxon OID: 3300001960
• Scaffold ID: GOS2230_1005877
• Source Dataset Name: Marine microbial communities from South of Charleston, South Carolina, USA - GS014
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1667
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Charleston, South Carolina, USA
• Coordinates
  • Lat. (^o): 32.506943
  • Long. (^o): -79.263885
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093529	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2230_10058774	F093529	GGA	MDRKSEDKFTEDDEKLLQQAIRFLKHRELCQEPFDGYWQDDDDV*